PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000152575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 285aa    MW: 32123.1 Da    PI: 7.8771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000152575genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.8e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l +++ + G g+W++++   g+ R +k+c++rw +yl
    MDP0000152575 15 KGLWSPEEDLRLRNYILKNGHGCWSSVPINTGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding491.4e-1568113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg + ++E+e ++ ++++lG++ W+ Ia++++ gRt++++k++w++yl
    MDP0000152575  68 RGTFCKQEEETILTLHRMLGNK-WSQIAQHLP-GRTDNEIKNYWHSYL 113
                      677889****************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0541062IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-201064IPR009057Homeodomain-like
SuperFamilySSF466894.03E-2713109IPR009057Homeodomain-like
SMARTSM007172.4E-91464IPR001005SANT/Myb domain
PfamPF002492.2E-121562IPR001005SANT/Myb domain
CDDcd001673.56E-81862No hitNo description
PROSITE profilePS5129425.15163117IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-2565117IPR009057Homeodomain-like
SMARTSM007173.8E-1467115IPR001005SANT/Myb domain
PfamPF002491.7E-1468113IPR001005SANT/Myb domain
CDDcd001671.97E-1073113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGCKPSDKPK AKYRKGLWSP EEDLRLRNYI LKNGHGCWSS VPINTGLQRN GKSCRLRWIN  60
YLRPGLKRGT FCKQEEETIL TLHRMLGNKW SQIAQHLPGR TDNEIKNYWH SYLKKKVAKA  120
EEMEGQTKSQ YTSTSSSEIL ECSPSPQKPT TCFNSSHESV QKSPPLVSQL DDLSKDQSCQ  180
RSPLPKILFA EWLSLDQVHG GSFANNIGDP WVLKEGFDHS TTSNNLQADH DLGHGFVLND  240
EGIFGSGFHH GISHHHGLGL EMINSQFKFE EQISGPGFVD FVSGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-221511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008377377.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K43e-60LAF1_ARATH; Transcription factor LAF1
TrEMBLM5XTG91e-151M5XTG9_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s13260.19e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-61myb domain protein 18